PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010878m
Common NameEUTSA_v10010878mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family S1Fa-like
Protein Properties Length: 77aa    MW: 8229.96 Da    PI: 10.5312
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010878mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA131.42.4e-41976370
             S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                     + ++eakG nPGlivllvvgg+l+vfl++n +lyvyaqknlPP+kkkPvskkklkreklkqGv+vPGe
  Thhalv10010878m  9 KMAAEAKGWNPGLIVLLVVGGPLVVFLIANCVLYVYAQKNLPPKKKKPVSKKKLKREKLKQGVPVPGE 76
                     6789***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.0E-361276IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MDGDDFAGKM AAEAKGWNPG LIVLLVVGGP LVVFLIANCV LYVYAQKNLP PKKKKPVSKK  60
KLKREKLKQG VPVPGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3701763e-80AF370176.1 Arabidopsis thaliana unknown protein (At3g53370) mRNA, complete cds.
GenBankAY0591363e-80AY059136.1 Arabidopsis thaliana unknown protein (At3g53370) mRNA, complete cds.
GenBankAY0888453e-80AY088845.1 Arabidopsis thaliana clone 97045 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403699.13e-47hypothetical protein EUTSA_v10010878mg
SwissprotQ423371e-21S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLV4LRP54e-47V4LRP5_EUTSA; Uncharacterized protein
STRINGBra006994.1-P2e-20(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769